21.9.2011 Konijn pAb (APR28745N)

The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo) . They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MFN1 Rabbit pAb (APR28745N) .

MFN1; hfzo1; hfzo2

55669

Q8IWA4

Cytoplasm, Mitochondrion outer membrane, Multi-pass membrane protein

IHC (Human bone marrow cancer cell) WB (Human bone marrow cancer cell, Homo sapiens, Rattus norvegicus, Gallus gallus, Mus musculus)

WB 1:500 - 1:2000 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 41kDa/71kDa/84kDa Observed MW: 84KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55669

https://www.uniprot.org/uniprot/Q8IWA4

YGALYLYERLSWTTHAKERAFKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES