ABCA5 Antilichaam - C-terminal regio : HRP (ARP43688_P050-HRP)

ATP-binding cassette, sub-family A (ABC1), member 5

HTC3, ABC13, EST90625

23461

Q8WWZ7

NP_061142

Human, Mouse, Rat, Cow, Dog, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human ABCA5

The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White) . ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White) . This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.

NR4A1; CYP2E1

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

186kDa

Ohtsuki, S., (2007) Biol. Pharm. Bull. 30 (6), 1144-1146

Wet Ice

1642

ABCA5

ABCA5

Rabbit

ATP-binding cassette sub-family A member 5

NM_018672

HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI