ABCC3 Antilichaam - middengebied: Biotine (ARP43645 P050-Biotine)

ATP-binding cassette, sub-family C (CFTR/MRP), member 3

MLP2, MRP3, ABC31, MOAT-D, cMOAT2, EST90757

8714

O15438

NP_003777

Human, Rat, Dog, Guinea Pig, Horse, Pig

The immunogen is a synthetic peptide directed towards the middle region of human ABCC3

ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

UBC; MLH1

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 77%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Pig: 86%; Rat: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

168kDa

Muller, P., (2008) Leuk. Res. 32 (6), 919-929

Wet Ice

1527

ABCC3

ABCC3

Rabbit

Canalicular multispecific organic anion transporter 2

NM_003786

KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL