ABL1 Konijn pAb (APR17394N)

This gene is a protooncogene that encodes a protein tyrosine kinase involved in a variety of cellular processes, including cell division, adhesion, differentiation, and response to stress. The activity of the protein is negatively regulated by its SH3 domain, whereby deletion of the region encoding this domain results in an oncogene. The ubiquitously expressed protein has DNA-binding activity that is regulated by CDC2-mediated phosphorylation, suggesting a cell cycle function. This gene has been found fused to a variety of translocation partner genes in various leukemias, most notably the t (9;22) translocation that results in a fusion with the 5' end of the breakpoint cluster region gene (BCR; MIM:151410) . Alternative splicing of this gene results in two transcript variants, which contain alternative first exons that are spliced to the remaining common exons.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABL1 Rabbit pAb (APR17394N) .

ABL; JTK7; p150; c-ABL; v-abl; CHDSKM; c-ABL1; ABL1; c-Abl; bcr/abl

25

P00519

Cytoplasm, Lipid-anchor, Mitochondrion, Nucleus, Nucleus membrane, cytoskeleton

WB (Mus musculus)

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 122kDa/124kDa Observed MW: 150KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25

https://www.uniprot.org/uniprot/P00519

HQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERL