Accn2 Antibody - N-terminal regio : HRP (ARP35035 P050-HRP)

Amiloride-sensitive cation channel 2, neuronal

A, AS, Acc, BNa, ASIC, Accn2, BNaC2, ASIC1a, AI843610, B530003N02Rik

11419

Q6NXK8

NP_033727

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Accn2 is a cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. It also permeable for Ca2+, Li+ and K+. It generates a biphasic current with a fast inactivating and a slow sustained phase and mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Accn2 functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. It modulates activity in the circuits underlying innate fear.

Asic2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

60kDa

Wet Ice

526

ASIC1

Asic1

Rabbit

Acid-sensing ion channel 1

NM_009597

MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF