Acd Antibody - C-terminal regio : HRP (ARP36813_P050-HRP)

Adrenocortical dysplasia

497652

Q5EE38

NP_001012656

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

The immunogen is a synthetic peptide directed towards the c terminal region of mouse Acd

Acd is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.Acd promotes binding of POT1 to single-stranded telomeric DNA.Acd modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.Acd plays a role in shelterin complex assembly. Acd may play an essential role in organogenesis of the developing embryo.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 83%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

45

Wet Ice

416

ACD

Acd

Rabbit

Adrenocortical dysplasia protein

NM_001012638

PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA