ADAM33 Antilichaam - middengebied HRP (ARP49937_P050-HRP)

ADAM metallopeptidase domain 33

C20orf153, DJ964F7.1

80332

Q9BZ11

NP_079496

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human ADAM33

ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

CLEC7A; SLC30A2; UBQLN4; ATXN7

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

62kDa

De (er) J Pediatr (Rio J) 84 (3) (2008) In press

Wet Ice

787

ADAM33

ADAM33

Rabbit

Disintegrin and metalloproteinase domain-containing protein 33

NM_025220

HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA