ADCY10 Antilichaam: Biotine (ARP47448_P050-Biotine)

Adenylate cyclase 10 (soluble)

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

55811

Q96PN6

NP_060887

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the following sequence LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD

The protein encoded by this gene belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction. Genetic variations in this gene are associated with absorptive hypercalciuria type 2. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

PTGIR; SSTR5

Biotin

Polyclonal Antibody

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

187 kDa

Wet Ice

1610

ADCY10

ADCY10

Rabbit

Adenylate cyclase type 10

NM_001167749

LMFVDISGFTAMTEKFSSAMYMDRGAEQLVEILNYHISAIVEKVLIFGGD