ALPP Antibody - C-terminal regio : FITC (ARP41959_T100-FITC)

Alkaline phosphatase, placental

ALP, IAP, ALPI, PALP, PLAP, PLAP-1

250

P05187

NP_001623

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human ALPP

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific) . The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific) . The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. The coding sequence for this form of alkaline phosphatase is unique in that the 3' untranslated region contains multiple copies of an Alu family repeat. In addition, this gene is polymorphic and three common alleles (type 1, type 2 and type 3) for this form of alkaline phosphatase have been well characterized.

COL2A1; KRTAP10-3; KRTAP4-12; KRTAP5-9; RPA3; RPA2; RPA1; FBXO6; LATS1; UBC; SUMO1; SUMO2; UBXN6; Cep76; Trim69; Erh; Cbx1; UBXN11; ASPSCR1; NSFL1C; UBXN1; UBXN7; FAF2; FAF1; ALPP; PIGK; GPLD1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

0.5 mg/ml

Cow: 86%; Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

59kDa

Kimura, K., (2006) Genome Res. 16 (1), 55-65

Wet Ice

535

ALPP

ALPP

Rabbit

Alkaline phosphatase, placental type

NM_001632

TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA