Amyloïde Beta Peptide 1-40 + C-term Cysteine Monomers

Amyloid Beta 1-40 peptide (Aβ40) is a major isoform implicated in Alzheimer’s disease, contributing to plaque formation and neurotoxicity despite being less aggregation-prone than Aβ42. Aβ40’s interaction with neural membranes and metal ions accelerates oligomerization and oxidative stress, disrupting neuronal function. Genetic factors like PLXNB1 influence glial responses and plaque morphology, modulating neuroinflammation and disease progression. StressMarq’s Amyloid Beta 1-40 + C-Term Cysteine Monomers are produced synthetically and present as a monomeric band at the expected molecular weight (MW) on SDS-PAGE via Coomassie Stain and Western Blot. This construct has a C-terminal cysteine to facilitate maleimide conjugations by the end-user for downstream applications where a label is desired.

Human Synthetic Amyloid Beta Peptide 1-40 + C-terminal Cysteine Monomers

Aβ 1-40-Cys, AB40-C, Amyloid beta 1-40-C, Beta-amyloid peptide (1-40) with cysteine, APP40-Cys, BAPP40-Cys, Modified Aβ40, Amyloid-beta (A4) precursor protein, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide (CVAP), Protease nexin-II (PN-II)

12352202

Non-hazardous

Non-hazardous

351

P05067

Synthetic

No Tag

Synthetic

WB | SDS-PAGE

Neuroscience | Neurodegeneration | Alzheimer's Disease | Amyloid

Certified > 95% pure using mass spec and HPLC

1 mg/mL

> 95%

PB pH7.4, 10mM NaCl

4.5 kDa

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

-80ºC

41 amino acids

1. Ghosh, P., Narang, K., & Iyer, P. K. (2024) . Role of Amyloid Beta in Neurodegeneration and Therapeutic Strategies for Neuroprotection. Methods in molecular biology (Clifton, N.J.), 2761, 337–354. https://doi.org/10.1007/978-1-0716-3662-6_25 2. Huang, Y., et al. (2024) . Regulation of cell distancing in peri-plaque glial nets by Plexin-B1 affects glial activation and amyloid compaction in Alzheimer’s disease. Nature Neuroscience, 27, 1489–1504. https://doi.org/10.1038/s41593-024-01664-w 3. Mirdha L. (2024) . Aggregation Behavior of Amyloid Beta Peptide Depends Upon the Membrane Lipid Composition. The Journal of membrane biology, 257 (3-4), 151–164. https://doi.org/10.1007/s00232-024-00314-3

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC

Human