Anti-Agouti-gerelateerd eiwit (AGRP) Antilichaam

AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.

Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.

Our Anti-Agouti related protein (AGRP) guinea pig polyclonal primary antibody detects human, mouse, rat, and sheep Agouti related protein (AGRP), and is whole serum. It is validated for use in IHC-Frozen.

Agrp; Agrt; Art; Agouti-related protein

P56473

Human, Mouse, Rat, and Sheep

A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.

Agouti related protein (AGRP)

Unconjugated

IHC-Frozen

Whole serum

For research use only.

25°C (ambient)

Spin vial briefly before opening. Reconstitute in 50 μL sterile-filtered, ultrapure water. Centrifuge to remove any insoluble material. Store lyophilized antibody at 2-8°C or lower. After reconstitution, divide into aliquots and store at -20°C, or lower, for optimal long term stability. It is recommended that a reconstituted aliquot is stored at 2-8°C for no longer than 2 weeks. Allocation of an appropriate anti-bacterial agent can increase shelf life by several weeks. Glycerol (1:1) can be added to neat serum for additional stability if intended use does not prevent this.

Neat serum

1:1000-1:2000

Specificity was demonstrated by immunohistochemistry. This antibody is known to react with human, rat and sheep. Other species have not yet been tested.

Guinea Pig

Lyophilized

Mixed

Mouse