Anti-GluA2/GluR2 Glutamate Receptor (L21/32) Recombinant Chicken Chimeric mAb FL550 Conjugate

Glutelin type-A 2 (GluA2), also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.

Our chicken Anti-GluA2/GluR2 glutamate receptor FL550 conjugate recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 is purified by affinity chromatography. It works in IHC, ICC.

Our chicken Anti-GluA2/GluR2 glutamate receptor FL550 conjugate recombinant monoclonal antibody is a chimeric antibody derived from NeuroMab clone L21/32. It detects human, mouse, and rat GluA2/GluR2 glutamate receptor and is purified by affinity chromatography. It works in IHC, ICC.

Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Gria2 Glur2

P19491

Human, Mouse, and Rat

Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli

GluA2/GluR2 glutamate receptor

L21/32

FL550 Ex: 550 nm, Em: 575 nm

Primary Antibodies

IHC, ICC

Cell Markers / Neuronal Markers / Synapse Markers / Post-synaptic Markers / Neurotransmitter Receptors / Glutamate Receptors

0.5 mg/mL

Purified by affinity chromatography

7.4

90 kDa

Shipped on ice packs

Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

This recombinant antibody is a chimeric antibody created by replacing the mouse heavy and light constant regions of clone L21/32 with chicken IgY heavy and light constant regions. As such this antibody retains the same binding performance as the original clone L21/32 but can be detected using standard anti-chicken secondary antibodies allowing flexibility for multiplexing applications. This antibody is expressed recombinantly in mammalian cells and then affinity purified from the cell culture media and conjugated.

1:250-1:500

Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

1:500

Each new lot of antibody is quality control tested by Western blot on rat brain membrane fraction and confirmed to stain the expected molecular weight band.

Aves Labs

Liquid

IgY

Rat

1