Anti-Wnt7a Polyklonale Antilichaam

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas €“ Rothschild / Schinzel phocomelia syndromes.

Protein Wnt-7a; WNT7A

WNT7A

7476

O00755

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence at the C-terminus of Human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related Mouse sequence.

Protein Wnt-7a

WB, IHC-P

Immunogen affinity purified.

Lyophilized

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. Reconstitute : Add 0.2ml of distilled water will yield a concentration of 500ug/mL.

At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Western blot : 0.1-0.5μg/ml; Immunohistochemistry (Paraffin-embedded Section) : 0.5-1μg/ml

Rabbit IgG