ANXA8L2 Antilichaam - middengebied: Biotine (ARP36574_P050-Biotine)

Annexin A8-like 2

ANXA8, bA145E20.2

244

P13928

NP_001621

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human ANXA8L2

ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 86%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Karanjawala, Z.E., (2008) Am. J. Surg. Pathol. 32 (2), 188-196

Wet Ice

327

ANXA8L2

ANXA8L2

Rabbit

Annexin A8

NM_001630

VFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTQNLHSYFAERLYYA