
APR5 Rabbit pAb (APR20645N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to the RII-beta regulatory subunit of PKA, and also to protein kinase C and the phosphatase calcineurin. It is predominantly expressed in cerebral cortex and may anchor the PKA protein at postsynaptic densities (PSD) and be involved in the regulation of postsynaptic events. It is also expressed in T lymphocytes and may function to inhibit interleukin-2 transcription by disrupting calcineurin-dependent dephosphorylation of NFAT.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AKAP5 Rabbit pAb (APR20645N) .
AKAP5; AKAP75; AKAP79; H21
9495
P24588
Lipid-anchor, Membrane
WB 1:500 - 1:2000 IF 1:50 - 1:200
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 47kDa Observed MW: 47kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9495
https://www.uniprot.org/uniprot/P24588
METTISEIHVENKDEKRSAEGSPGAERQKEKASMLCFKRRKKAAKALKPKAGSEAADVARKCPQEAGASDQPEPTRGAWASLKRLVTRRKRSESSKQQKPLEGEMQPAINAEDADLSKKKAKSRLKIPCIKFPRGPKRSNHSKIIEDSDCSIKVQEEAEILDIQTQTPLNDQATKAKSTQDLSEGISRKDGDEVCESNVSNSTTSGEKVISVELGLDNGHSAIQTGTLILEEIETIKEKQDVQPQQASPLETSETDHQQPVLSDVPPLPA
Beschrijving
APR5 Rabbit pAb (APR20645N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg

Human Sertoli Cell Complete Medium
MBS2576755-01
100 mL

Urobilinogen protein
MBS5303823-01
100 mg

AffiniPure Goat Anti-Rabbit IgG H&L, HRP conjugated
GTR17765564-01
100 µL

Pribolab® Automatic Immunoaffinity Column Purification System
HWEQ-IM 5050
1 Unit

OneTaq Hot Start 2X Master Mix with GC Buffer
NEB M0485L
500 Reactions
Recent gezochte producten

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (MaxLight 750)
MBS6236090-01
0.1 mL

Vascular Endothelial Growth Factor A (VEGFA, VEGF-A, VEGF, Vascular Permeability Factor, VPF, MVCD1) (MaxLight 750)
MBS6236092-01
0.1 mL

Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) (MaxLight 750)
MBS6236093-01
0.1 mL

VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 750)
MBS6236094-01
0.1 mL

VGLL1 (Transcription Cofactor Vestigial-like Protein 1, VGL1, Vgl-1, Protein TONDU, TDU) (MaxLight 750)
MBS6236095-01
0.1 mL

VHL (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7, HRCA1, RCA1, VHL1) (MaxLight 750)
MBS6236096-01
0.1 mL

Villin-1 (VIL1, VIL, D2S1471) (MaxLight 750)
MBS6236097-01
0.1 mL
