APRIL/TNFSF13 Trimer, Human (HEK293, His-Flag)

APRIL protein (CD256) is a ligand in the tumor necrosis factor (TNF) family that can induce proliferation, regulate tumor cell growth, and may participate in mononuclear/macrophage-mediated immune process[1]. APRIL protein is produced by myeloid cells and their precursors to accelerate cell maturation and peripheral rupture[2]. APRIL protein has been widely used in the study of lymphatic malignancies. Human APRIL protein is a type II membrane protein with cytoplasmic domain, hydrophobic transmembrane domain and extracellular domain. APRIL/TNFSF13 Protein, Human (HEK293, His-Flag) is produced by HEK293 cells (K112-L250) with N-terminal His and Flag-tags.

APRIL/TNFSF13 Trimer Protein, Human (HEK293, His-Flag), Human, HEK293

12352202

98.0

KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

8741 (Gene_ID) O75888 (K112-L250) (Accession)

Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins