ARF1 Antilichaam - middelste regio : HRP (ARP48184_P050-HRP)

ADP-ribosylation factor 1

PVNH8

375

P61204

NP_001649

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish, Yeast

The immunogen is a synthetic peptide directed towards the middle region of human ARF1

ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

GGA1; GGA3; GGA2; HUWE1; UBC; FBXO6; MMS19; TMEM106A; VCAM1; ITGA4; ATF2; ARF3; UBD; GRK5; CDK2; HERC1; Proser1; AI837181; Kif1c; Bach1; nef; COPB1; GEA1; WBP11; TMED2; PICK1; NOA1; TMED10; EEF1G; PLEKHA8; COPG1; ARFIP1; ARFIP2; ARHGAP21; ARFGAP1; AP3D1

HRP: Horseradish Peroxidase

Polyclonal Antibody

IHC, IP, WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

21kDa

Hattori, Y., (2007) Biochem. Biophys. Res. Commun. 364 (4), 737-742

Wet Ice

181

ARF1

ARF1

Rabbit

ADP-ribosylation factor 3

NM_001658

MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA