ARGAP11B Konijn pAb (APR23188N)

Hominin-specific protein that promotes development and evolutionary expansion of the brain neocortex. Able to promote amplification of basal progenitors in the subventricular zone, producing more neurons during fetal corticogenesis, thereby playing a key role in neocortex expansion. Promotes the proliferation of basal progenitors by inhibiting the mitochondrial permeability transition pore (mPTP: delays the opening of the mPTP via interaction with ADP:ATP translocase, thereby increasing mitochondrial Ca (2+ concentration and inducing glutamine catabolism, which is required for basal progenitor proliferation. Does not possess GTPase activator activity: the absence of GTPase activator activity is required to promote amplification of basal progenitors during neocortex development.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ARHGAP11B Rabbit pAb (APR23188N) .

ARHGAP11B; FAM7B1

89839

Q3KRB8

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 30kDa Observed MW: 30kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=89839

https://www.uniprot.org/uniprot/Q3KRB8

EKKGVYQTLSWKRYQPCWVLMVSVLLHHWKALKKVNMKLLVNIREREDNV