ARGFX Antilichaam - N-terminalgebied: FITC (ARP47510 P050-FITC)

Arginine-fifty homeobox

503582

A6NJG6

NP_001012677

Human, Cow, Pig

The immunogen is a synthetic peptide directed towards the N terminal region of human ARGFX

ARGFX belongs to the paired homeobox family.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-83 AC069239.16 30152-30234 c 84-198 AC069239.16 27349-27463 c 199-315 AC069239.16 21265-21381 c 316-464 AC069239.16 13100-13248 c 465-5065 AC069239.16 7543-12143 c

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 90%; Human: 100%; Pig: 91%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

35kDa

Booth, H.A. Gene 387 (1-2), 7-14 (2007)

Wet Ice

315

ARGFX

ARGFX

Rabbit

Arginine-fifty homeobox

NM_001012659

TTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPEST