ARGFX Antilichaam - N-terminalgebied: HRP (ARP47512 T100-HRP)

Arginine-fifty homeobox

503582

A6NJG6

NP_001012677

Human, Yeast

The immunogen is a synthetic peptide directed towards the N terminal region of human ARGFX

Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. ARGFX gene is a member of the ARGFX homeobox gene family.Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-83 AC069239.16 30152-30234 c 84-198 AC069239.16 27349-27463 c 199-315 AC069239.16 21265-21381 c 316-464 AC069239.16 13100-13248 c 465-5065 AC069239.16 7543-12143 c

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Human: 100%; Yeast: 83%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

35kDa

Booth, H.A. Gene 387 (1-2), 7-14 (2007)

Wet Ice

315

ARGFX

ARGFX

Rabbit

Arginine-fifty homeobox

NM_001012659

MFPDRNLQEKLALRLDLPESTVKVWFRNRRFKLKKQQQQQSAKQRNQILP