ARID3A Antilichaam - N-terminalgebied: FITC (ARP38587_P050-FITC)

AT rich interactive domain 3A (BRIGHT-like)

DRIL1, DRIL3, BRIGHT, E2FBP1

1820

Q99856

NP_005215

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Pig

The immunogen is a synthetic peptide directed towards the N terminal region of human ARID3A

ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene encodes a member of the ARID (AT-rich interaction domain) family of DNA binding proteins. It was found by homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation, and possibly in chromatin structure modification. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-396 BC060828.1 1-396 397-2254 U88047.1 307-2164 2255-2766 CR598405.1 1491-2002 2767-2823 BC060828.1 2769-2825

NOTCH2NL; TTC32; UBC; SOX2; TP53BP1; APP; UBE2E3; TP53; SP100; PML; E2F4; E2F2; RL2; ELAVL1; SUMO2; BTK; E2F1; DSP

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 83%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

63kDa

Lin, D., (er) Mol. Cancer 6, 23 (2007)

Wet Ice

593

ARID3A

ARID3A

Rabbit

AT-rich interactive domain-containing protein 3A

NM_005224

MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE