ARID3C Antilichaam - C-terminaal gebied: Biotine (ARP50384 P050-Biotine)

AT rich interactive domain 3C (BRIGHT-like)

138715

A6NKF2

NP_001017363

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3C

ARID3C is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-318 AL450283.16 15235-15552 c 319-391 AL450283.16 13280-13352 c 392-575 AL450283.16 11402-11585 c 576-865 AL450283.16 10963-11252 c 866-1048 AL450283.16 9885-10067 c 1049-1138 AL450283.16 9558-9647 c 1139-1239 AL450283.16 8996-9096 c

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

44kDa

Wilsker, D., (2002) Cell Growth Differ. 13 (3), 95-106

Wet Ice

412

ARID3C

ARID3C

Rabbit

AT-rich interactive domain-containing protein 3C

NM_001017363

MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING