ASZ1 Antilichaam - middengebied: Biotine (ARP52537_P050-Biotine)

Ankyrin repeat, SAM and basic leucine zipper domain containing 1

ALP1, GASZ, Orf3, ANKL1, C7orf7, CT1.19

136991

Q8WWH4

NP_570124

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human ASZ1

ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.ASZ1 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process.ASZ1 is required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons.ASZ1 may act by mediating protein-protein interactions during germ cell maturation.

TSG101

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

53kDa

Wet Ice

475

ASZ1

ASZ1

Rabbit

Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1

NM_130768

GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR