Atf7ip Antilichaam - middelste regio : HRP (ARP37246_P050-HRP)

Activating transcription factor 7 interacting protein

A, AM, Mcaf, Mcaf1, 2610204M12Rik, 5830415B17Rik

54343

Q7TT18

NP_062299

Mouse, Rat, Pig

The immunogen is a synthetic peptide directed towards the middle region of Mouse Atf7ip

Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Atf7ip can both act as an activator or a repressor depending on the context. It mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Atf7ip is required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3) . The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3) . Atf7ip may have ATPase activity.

Atf7; Gtf2f1; Gtf2e2; Aagab; Ccnh; Gtf2h1; Ercc3; Cdk7; C1qbp; POLR2H; POLR2G; POLR2D; POLR2C

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Mouse: 100%; Pig: 92%; Rat: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

138kDa

Wet Ice

1306

ATF7IP

Atf7ip

Rabbit

Activating transcription factor 7-interacting protein 1

NM_019426

MSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVESK