ATG2A Rabbit pab (APR28355N)

Lipid transfer protein involved in autophagosome assembly. Tethers the edge of the isolation membrane (IM to the endoplasmic reticulum (ER and mediates direct lipid transfer from ER to IM for IM expansion. Binds to the ER exit site (ERES, which is the membrane source for autophagosome formation, and extracts phospholipids from the membrane source and transfers them to ATG9 (ATG9A or ATG9B to the IM for membrane expansion. Lipid transfer activity is enhanced by WIPI1 and WDR45/WIPI4, which promote ATG2A-association with phosphatidylinositol 3-monophosphate (PI3P-containing membranes. Also regulates lipid droplets morphology and distribution within the cell.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATG2A Rabbit pAb (APR28355N) .

ATG2A

23130

Q2TAZ0

Lipid droplet, Peripheral membrane protein, Preautophagosomal structure membrane

WB 1:500 - 1:2000

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 13kDa/35kDa/212kDa/213kDa Observed MW: 213kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23130

https://www.uniprot.org/uniprot/Q2TAZ0

DLHGIYEDGGKPPVPCLRVSKALDPKSTGRKYFLPQVVVTVNPQSSSTQWEVAPEKGEELELSVESPCELREPEPSPFSSKRTMYETEEMVIPGDPEEMRT