ATP2A3 Antilichaam - middengebied: HRP (ARP46580_P050-HRP)

ATPase, Ca++ transporting, ubiquitous

SERCA3

489

Q93084

NP_005164

Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human ATP2A3

ATP2A3 is one of the SERCA Ca (2+) -ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.This gene encodes one of the SERCA Ca (2+) -ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.

BCL2; UBC; BMI1; HDAC11; env; ATF2; CDK2; TCF3; IRS1; WRAP73

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

ATP2A3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

0.5 mg/ml

Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Rabbit: 77%; Rat: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

109kDa

Korosec, B., (2008) Cancer Genet. Cytogenet. 181 (2), 112-118

Wet Ice

999

ATP2A3

ATP2A3

Rabbit

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

NM_005173

LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS