Bax, mens (zijn)

Bax Protein, Human (His) suppresses tumorigenesis and stimulates apoptosis. BCL2L4 (BAX) is the proapoptotic members of the Bcl-2 family that are ubiquitously expressed in different tissues[1][2][3].

Bax Protein, Human (His), Human, E. coli

12352202

95.00

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQ

581 (Gene_ID) Q07812-1 (M1-Q171) (Accession)

Approximately 20 kDa

[1]Chaoying Yin, et al. Bax suppresses tumorigenesis and stimulates apoptosis in vivo. Nature. 1997 Feb 13;385 (6617) :637-40.|[2]Luca Scorrano, et al. BAX and BAK regulation of endoplasmic reticulum Ca2+: a control point for apoptosis. Science. 2003 Apr 4;300 (5616) :135-9.|[3]Wei-Xing Zong, et al. Bax and Bak can localize to the endoplasmic reticulum to initiate apoptosis. J Cell Biol. 2003 Jul 7;162 (1) :59-69.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins