Bmi1 Antilichaam - middengebied: FITC (ARP33655 P050-FITC)

Bmi1 polycomb ring finger oncogene

Bmi, Bmi-, Pcgf, Bmi-1, Pcgf4, AW546694

12151

P25916

NP_031578

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Bmi1 is a component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.

Rnf2; Eed; Aurkb; Phc2; RING1; Gata6; Mph1; Cbfb; Runx1; Cdkn2a; HIST2H2AC; Slc11a1; Dnmt3b; Kdm2b; Phc1; Cbx2; Phc3; Dmap1; CBX8; SCMH1; CBX4; SMARCA5; HSPA4

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 77%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Wet Ice

324

BMI1

Bmi1

Rabbit

Polycomb complex protein BMI-1

NM_007552

MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK