CACNG6 Antilichaam - N-terminalgebied: FITC (ARP35369_P050-FITC)

Calcium channel, voltage-dependent, gamma subunit 6

59285

Q9BXT2

NP_665813

Human, Mouse, Rat, Dog, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG6

CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes. Three transcript variants encoding different isoforms have been found for this gene.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 90%; Human: 100%; Mouse: 91%; Rabbit: 92%; Rat: 91%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

28kDa

Chu, P.J., Gene 280 (1-2), 37-48 (2001)

Wet Ice

260

CACNG6

CACNG6

Rabbit

Voltage-dependent calcium channel gamma-6 subunit

NM_145814

MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA