CARD9 Antilichaam - middengebied: HRP (ARP57704_P050-HRP)

Caspase recruitment domain family, member 9

CANDF2, hCARD9

64170

Q9H257

NP_434700

Human, Mouse, Dog, Horse

The immunogen is a synthetic peptide directed towards the middle region of human CARD9

The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD) . CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined.

KRTAP10-3; MFAP1; MEOX2; LMO1; ABLIM1; KRT31; KRT19; PHC2; DAXX; TRIM23; AES; KRTAP10-5; KRTAP10-1; CCDC36; TRIM42; CEP57L1; RTP5; PPP1R18; TCEANC; ALS2CR11; ZNF417; CWF19L2; ZNF572; KRT40; SSX2IP; PNMA5; C1orf94; ZNF587; LZTS2; ZCCHC7; FAM161A; CEP70; FA

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 92%; Horse: 86%; Human: 100%; Mouse: 90%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

62kDa

Wet Ice

536

CARD9

CARD9

Rabbit

Caspase recruitment domain-containing protein 9

NM_052813

ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR