CATSPER2 Antilichaam - C-terminal regio : HRP (ARP35452 T100-HRP)

Cation channel, sperm associated 2

117155

Q96P56

NP_473361

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast

The immunogen is a synthetic peptide directed towards the C terminal region of human CATSPER2

Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. This gene is part of a tandem repeat on chromosome 15q14; the second copy of this gene is thought to be a pseudogene. Additional splice variants have been described but their full-length nature has not been determined.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 86%; Yeast: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

58kDa

Quill, T.A., et al., (2001) Proc. Natl. Acad. Sci. U.S.A. 98 (22), 12527-12531

Wet Ice

528

CATSPER2

CATSPER2

Rabbit

Cation channel sperm-associated protein 2

NM_054020

LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK