CATSPER2 Antilichaam - N-terminalgebied: FITC (ARP35453 P050-FITC)

Cation channel, sperm associated 2

MGC33346

117155

Q96P56

NP_742094

Human, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human CATSPER2

Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

CATSPER2 is supported by BioGPS gene expression data to be expressed in HEK293T

0.5 mg/ml

Cow: 93%; Dog: 92%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

46kDa

Wet Ice

414

CATSPER2

CATSPER2

Rabbit

Cation channel sperm-associated protein 2

NM_172096

HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA