CCL23 Antilichaam - middengebied: HRP (ARP30862 P050-HRP)

CKb8, MIP3, Ckb-8, MIP-3, MPIF-1, SCYA23, Ckb-8-1, hmrp-2a, CK-BETA-8

6368

P55773

NP_665905

Human

The immunogen is a synthetic peptide directed towards the middle region of Human CCL23

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity on resting T lymphocytes and monocytes, lower activity on neutrophils and no activity on activated T lymphocytes. The protein is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. In addition, the product of this gene is a potent agonist of the chemokine (C-C motif) receptor 1. Alternative splicing results in multiple transcript variants that encode different isoforms.

CCR1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

13kDa

Wet Ice

120

CCL23

CCL23

Rabbit

SADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDK