CD8B Antilichaam - N-terminaal gebied: Biotine (ARP42204 P050-Biotine)

CD8b molecule

LY3, P37, LEU2, LYT3, CD8B1

926

Q53QL8

NP_742097

Human, Rat, Dog, Guinea Pig, Horse

The immunogen is a synthetic peptide directed towards the N terminal region of human CD8B

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. CD8B is the CD8 beta chain isoforms.The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize antigen displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The functional coreceptor is either a homodimer composed of two alpha chains, or a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 beta chain isoforms. Multiple alternatively spliced transcript variants encoding distinct membrane associated or secreted isoforms have been described. A pseudogene, also located on chromosome 2, has been identified.

ELAVL1; CD8A; CD3D; CD8B; ST3GAL4; LCK

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Rat: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

27kDa

Moody, A.M., (2003) J. Biol. Chem. 278 (9), 7240-7246

Wet Ice

246

CD8B

CD8B

Rabbit

Putative uncharacterized protein CD8B1 EMBL AAY24019.1

NM_172099

RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI