CDK1 Rabbit pAb (APR17346N)

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK1 Rabbit pAb (APR17346N) .

CDK1; CDC2; CDC28A; P34CDC2

983

P06493

Cytoplasm, Mitochondrion, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle

WB (Human gastric cancer cells, Human tumor cell, HeLa, HCT116, Mus musculus, Homo sapiens, Rattus norvegicus) IP (Rattus norvegicus) IF (Homo sapiens)

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 27kDa/34kDa Observed MW: 34KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=983

https://www.uniprot.org/uniprot/P06493

SEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDE