CDK11A Antilichaam - C-terminalgebied: Biotine (ARP61814 P050-Biotine)

Cyclin-dependent kinase 11A

CDC2L2, CDC2L3, p58GTA, PITSLRE, CDK11-p46, CDK11-p58, CDK11-p110

728642

Q9UQ88

NP_277071

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

This gene encodes a member of the p34Cdc2 protein kinase family. p34Cdc2 kinase family members are known to be essential for eukaryotic cell cycle control. This gene is in close proximity to CDC2L1, a nearly identical gene in the same chromosomal region. The gene loci including this gene, CDC2L1, as well as metalloprotease MMP21/22, consist of two identical, tandemly linked genomic regions, which are thought to be a part of the larger region that has been duplicated. This gene and CDC2L1 were shown to be deleted or altered frequently in neuroblastoma with amplified MYCN genes. The protein kinase encoded by this gene could be cleaved by caspases and was demonstrated to play roles in cell apoptosis. Many transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only two have been determined so far.

UBC; CDC37; FKBP5; PIN1; CDK11A; HKR1; C18orf25; RBM25; ZFP14; PRPF40A; NOP58; ZNF510; ZNF460; ZNF267; ZNF33A; PSMD1; KPNA2; KPNB1; CSNK2B; CSNK2A2; CSNK2A1; CDKN2A; A2M; SOX2; Dlg4; GADD45A; HSP90AA1; SMAD3; SUMO2; CCNL1; SRSF7; RNPS1; KAT7; PAK1; CASP8

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

84kDa

Wet Ice

767

CDK11A

CDK11A

Rabbit

Cyclin-dependent kinase 11A

NM_033529

EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDL