CDK19 Antilichaam - C-terminalgebied : HRP (ARP55155_P050-HRP)

Cyclin-dependent kinase 19

CDK11, DEE87, CDC2L6, EIEE87, bA346C16.3

23097

Q9BWU1-2

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK19

This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex.

MED6; MED13; MED12; MED24; MED20; MED7; MED22; MASP1; MED1; PIP; CLU; CCNC; AZGP1; APOD; MED17; MED23; MED14; MED11; MED8; MED30; MED28; MED29; MED9; MED18; MED15; MED31; MED4; MED13L; CDK19; ERC1; MED16; MED27; MED19; MED26; NIFK; RNPC3; COMMD4; CUTA; MY

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

48kDa

Wet Ice

442

CDK19

CDK19

Rabbit

Cyclin-dependent kinase 19

LLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDP