CDY1 Antilichaam - C-terminal regio : HRP (ARP48645_T100-HRP)

Chromodomain protein, Y-linked, 1

CDY, CDY1A

9085

A8K8F3

NP_004671

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

The immunogen is a synthetic peptide directed towards the C terminal region of human CDY1

CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. Two protein isoforms are encoded by transcript variants of this gene. Additional transcript variants have been described, but their full-length nature has not been determined.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 86%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

62kDa

Stouffs, K., (2008) Hum. Reprod. 23 (5), 1193-1199

Wet Ice

554

CDY1

CDY1

Rabbit

CDNA FLJ76680, highly similar to Homo sapiens chromodomain protein, Y-linked, 1 (CDY1), transcript variant 2, mRNA EMBL BAF85007.1

NM_004680

FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF