CEACAM8 Rabbit pAb (APR30127N)

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8 (CEACAM8) is a single chain, GPI-anchored, highly glycosylated protein which belongs to the immunoglobulin superfamily and the carcinoembryonic antigen (CEA) family. CEACAM8 is expressed by neutrophils and eosinophils, and serves as a binding partner for CEACAM-6 and Galectin-3. It contains two Ig-like C2-type (immunoglobulin-like) domains and one Ig-like V-type (immunoglobulin-like) domain. Mature human CEACAM8 is a 287 amino acid GPI-linked glycoprotein. CEACAM family members are a set of widely expressed proteins involved in several biological functions, including cell adhesion, migration, signal transduction, and the regulation of gene expression. Abnormal overexpression and downregulation of some CEACAMs have been described in tumor cells.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CEACAM8 Rabbit pAb (APR30127N) .

CEACAM8; CD66b; CD67; CGM6; NCA-95

1088

P31997

Cell membrane, GPI-anchor, Lipid-anchor

WB 1:500 - 1:2000 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 38kDa Observed MW: Refer to figures

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1088

https://www.uniprot.org/uniprot/P31997

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD