CES2 Antilichaam - C-terminal regio : HRP (ARP42158 P050-HRP)

Carboxylesterase 2

ICE, CE-2, PCE-2, CES2A1

8824

O00748

NP_003860

Human, Mouse, Rat, Dog, Guinea Pig

The immunogen is a synthetic peptide directed towards the C terminal region of human CES2

Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB, IHC

Affinity Purified

CES2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

0.5 mg/ml

Dog: 83%; Guinea Pig: 83%; Human: 100%; Mouse: 83%; Rat: 83%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

69kDa

Kimura, K., (2006) Genome Res. 16 (1), 55-65

Wet Ice

623

CES2

CES2

Rabbit

Cocaine esterase

NM_003869

HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH