CIITA Antibody - C-terminal regio : HRP (ARP36830_P050-HRP)

Class II transactivator

C2t, C2ta, Gm9475, Mhc2ta, EG669998

12265

Q3U2P0

NP_031601

Human, Mouse, Rat, Dog

The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA

This gene encodes a member of the NOD-like receptor protein family. This protein acts as a transcriptional coactivator and component of the enhanceosome complex to stimulate transcription of MHC class II genes in the adaptive immune response. This protein may also regulate the transcription of MHC class I genes. Mutations in the human gene have been linked to a rare immunodeficiency, bare lymphocyte syndrome, and homozygous knockout mice exhibit many features of this disease. Alternative splicing results in multiple transcript variants encoding different isoforms.

Rfxank; Ssbp4; Ssbp3; Gmeb1; Cited4; Tcf3; Nfe2; Hoxa2; Ewsr1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 100%; Human: 79%; Mouse: 100%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

119kDa

Pennini, M.E., et al., (2006) J. Immunol. 176 (7), 4323-4330

Wet Ice

1078

CIITA

CIITA

Rabbit

MHC class II transactivator

NM_007575

MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN