Cish Antibody - N-terminal regio : FITC (ARP52798 P050-FITC)

Cytokine inducible SH2-containing protein

C, CI, Cis, F17, F23, CIS1, SOCS, CIS-1

12700

Q62225

NP_034025

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide corresponding to a region of Mouse

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

GHR; Socs2; Lepr; Epor; Prkcq; Prkcb; Prkca; Ubc; Abl1; Cul5; TCEB2; TCEB1; Stat5a

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

28kDa

Wet Ice

257

CISH

Cish

Rabbit

Cytokine-inducible SH2-containing protein

NM_009895

RESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPT