CLEC17A, menselijk (HEK293, hFc)

CLEC17A Protein, a cell surface receptor, engages in carbohydrate-mediated intercellular communication in the germinal center. It shows affinity for glycans with alpha-linked mannose or fucose residues. As an oligomer formed through disulfide linkages, CLEC17A is crucial for complex molecular interactions, contributing to essential cellular processes within the germinal center. CLEC17A Protein, Human (CHO, hFc) is the recombinant human-derived CLEC17A protein, expressed by CHO , with N-hFc labeled tag.

CLEC17A Protein, Human (HEK293, hFc), Human, HEK293

12352202

KYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTKSWDEARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDWRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWICERKCSC

388512 (Gene_ID) Q6ZS10-1 (K194-C378) (Accession)

Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Room temperature in continental US; may vary elsewhere.

Recombinant Proteins