CLOCK Antilichaam
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.
Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells
O15516
• Rabbit
Human, Mouse, Rat, Monkey
Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK were used as the immunogen for the CLOCK antibody.
• Polyclonal
• IgG
WB, IHC-P, IF, FACS
Antigen affinity
Antigen affinity purified
Lyophilized from 1X PBS with 2% Trehalose
This CLOCK antibody is available for research use only.
After reconstitution, the CLOCK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
0.5 mg/mL if reconstituted with 0.2ml sterile DI water
Optimal dilution of the CLOCK antibody should be determined by the researcher.
Nuclear, cytoplasmic
Immunofluorescent staining of FFPE human U-2 OS cells with CLOCK antibody (green) and Alpha Tubulin mAb (red) . HIER: steam section in pH6 citrate buffer for 20 min.
Beschrijving
CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rh
Specificaties
Recent bekeken producten

1,4- Dioxane Pure
1041330 500
500 mL

Benzonase ELISA Kit
EG23601S
96 Tests

Not I Restriction Enzyme
B2016623
500 Units

K562-HLA-G0101 Overexpressing Cell Line
RG-1214
5x 10^6

Yeast Poly (A) Polymerase
RNT-006-S
30000 Units

Arachis hypogaea Lectin (PNA) - Biotinylated
21510020-1
5mg

Arachis hypogaea lectin (PNA)
05-0116-10mg
10 mg

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg
