CLOCK Antilichaam

CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

O15516

Human, Mouse, Rat, Monkey

Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK were used as the immunogen for the CLOCK antibody.

WB, IHC-P, IF, FACS

Antigen affinity

Antigen affinity purified

Lyophilized from 1X PBS with 2% Trehalose

This CLOCK antibody is available for research use only.

After reconstitution, the CLOCK antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Optimal dilution of the CLOCK antibody should be determined by the researcher.

Nuclear, cytoplasmic

Immunofluorescent staining of FFPE human U-2 OS cells with CLOCK antibody (green) and Alpha Tubulin mAb (red) . HIER: steam section in pH6 citrate buffer for 20 min.