COX18 Antilichaam - middengebied HRP (ARP55716 P050-HRP)

COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)

COX18HS

285521

Q8N8Q8

NP_776188

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human COX18

COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.COX18 encodes a cytochrome c oxidase (COX) -assembly protein. The S. cerevisiae Cox18 protein catalyzes the insertion of the Cox2 (MTCO2; MIM 516040) C-terminal tail into the mitochondrial inner membrane, an intermediate step in the assembly of complex IV of the mitochondrial respiratory chain (Sacconi et al., 2005 [PubMed 16212937]) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1248 AY957565.1 1-1248 1249-4523 AC095053.3 75071-78345 c

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

37kDa

Gaisne, M. (2006) FEMS Yeast Res. 6 (6), 869-882

Wet Ice

333

COX18

COX18

Rabbit

Mitochondrial inner membrane protein COX18

NM_173827

LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR