CPNE1 Antilichaam - middelste regio : HRP (ARP40503 P050-HRP)

Copine I

CPN1, COPN1

8904

Q99829

NP_003906

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human CPNE1

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.

UBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

CPNE1 is supported by BioGPS gene expression data to be expressed in HeLa

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

59kDa

Ma, J., (2007) Atherosclerosis 191 (1), 63-72

Wet Ice

537

CPNE1

CPNE1

Rabbit

Copine-1

NM_003915

VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG