CRB1 Antilichaam

Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/million cells

P82279

Human, Mouse, Rat

Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.

WB, IHC-P, FACS

Affinity purified

Antigen affinity purified

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

This CRB1 antibody is available for research use only.

Store the CRB1 antibody at -20°C.

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Optimal dilution of the CRB1 antibody should be determined by the researcher.

Western blot testing of human 1) HEK293 and 2) U-87 MG cell lysate with CRB1 antibody. Predicted molecular weight ~154 kDa.