Cycline B1 Rabbit pAb (APR24582N)

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34 (cdc2) to form the maturation-promoting factor (MPF) . Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cyclin B1 Rabbit pAb (APR24582N) .

CCNB; CCNB1; Cyclin B1; cyclin B1

891

P14635

Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center

WB (H460, Human tumor cell, MEF, A172, HeLa, HCT116, Homo sapiens, Mus musculus, Rattus norvegicus)

WB 1:500 - 1:2000 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 44kDa/48kDa Observed MW: 55KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=891

https://www.uniprot.org/uniprot/P14635

TMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV