
CYP1A1 Antilichaam - middengebied: HRP (ARP41405_P050-HRP)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Cytochrome P450, family 1, subfamily A, polypeptide 1
AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX
1543
P04798
NP_000490
• Rabbit
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
CMTM5; CYB5A
• Polyclonal
HRP: Horseradish Peroxidase
Polyclonal Antibody
WB
Affinity Purified
0.5 mg/ml
Cow: 93%; Dog: 83%; Goat: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
58kDa
Ikeda, S., (2008) Am. J. Gastroenterol. 103 (6), 1476-1487
Wet Ice
512
CYP1A1
CYP1A1
Rabbit
Cytochrome P450 1A1
NM_000499
QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
Beschrijving
CYP1A1 Antilichaam - middengebied: HRP (ARP41405_P050-HRP) Beschikbaar in 100 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Anti- Protein A Antibody
GWB-E66F30
1 mL

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg
