CYP2C19 Antilichaam - middelste regio: HRP (ARP41807_P050-HRP)

Cytochrome P450, family 2, subfamily C, polypeptide 19

CPCJ, CYP2C, P450C2C, CYPIIC17, CYPIIC19, P450IIC19

1557

P33261

NP_000760

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human CYP2C19

CYP2C19 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

POR

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

CYP2C19 is supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Cow: 86%; Dog: 86%; Goat: 75%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 93%; Rat: 92%; Sheep: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

56kDa

Justenhoven, C., (er) Breast Cancer Res. Treat. (2008) In press

Wet Ice

490

CYP2C19

CYP2C19

Rabbit

Cytochrome P450 2C19

NM_000769

QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD